Quicksearch Help

(Click the icon to keep this page displayed.)

EMAGE:3501

En2 engrailed 2 ( MGI:95390)
TS16 (10.0-10.5 dpc)
immunohistochemistry

Data Images
EMAGE:3501
Figure 1A of Degenhardt et al., 2002 [PMID:11804784] . Copyright: Reprinted with permission from Elsevier from [doi:10.1016/S0925-4773(01)00618-9] Mech Dev 111: 125-36, Degenhardt K; Rentschler S; Fishman G; Sassoon DA, Cellular and cis-regulation of En-2 expression in the mandibular arch. Copyright 2002.

Expression pattern clarity: two stars
Find spatially similar wholemount expression patterns: Find spatially similar wholemount patterns
Notes:
Note: Presence of engrailed protein in the midbrain/hindbrain (blue arrow) region as well as the first arch (red arrow).
Expression Pattern Description
Spatial Annotation:
EMAGE:3501Annotation colour key:  
strong strong      
gene expression moderate moderate    
gene expression weak weak        
gene expression possible possible    
gene expression not detected not detected
wholemount mapping

Download individual expression domains:
3501_wholemount_strong_3D_1.wlz
3501_wholemount_moderate_3D_1.wlz
3501_wholemount_weak_3D_1.wlz
3501_wholemount_possible_3D_1.wlz
3501_wholemount_notDetected_3D_1.wlz
(what is wlz format?)
Download all expression domains: EMAGE:3501_all_domains.zip
Find spatially similar wholemount expression patterns:  EMAGE spatially similar wholemount patterns
Morphological match to the template: three stars
Text Annotation:
StructureLevelPatternNotes
future midbrain
detected detected
regionalExpression at the midbrain-hindbrain junction.
future hindbrain
detected detected
regionalExpression at the midbrain-hindbrain junction.
1st branchial arch mandibular component
detected detected
Annotation Validation: EMAGE Editor
Detection Reagent
Type:antibody
Identifier:MGI:1276057
Entity Detected:En2, engrailed 2 ( MGI:95390)
Antigen:sense strand is shown

>MGI:1276057
WVYCTRYSDRPSSGPRSRKPKKKNPNKEDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELSLNE
SQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE
aa 207 - aa 324 of NP_034264.1
Notes:The antibody used to detect EN2 in this study by Degenhardt et al., 2002 [PMID:11804784] is anti-Enhb, described as follows: "The generation of the anti-Enhb antibody has been described previously (Davis et al., 1991). Briefly, a fusion protein of bacterial TrpE and the c-terminal 117 amino acid of En-2 (which includes the homeodomain) was purified, and antisera against this protein was raised in rabbits". Davis et al., 1991 [PMID:1680044] describe it as specific to the "117 amino acids from the carboxyl terminus of the En-2 protein". Antigen recognition note: The antiserum binds to a 41000 Mr and a 55000 Mr band in mouse. These bands were concluded to be mouse En-2 and En-1 proteins, respectively.
Antibody Type:polyclonal
Raised In:rabbit
Specimen
Organism:mouse
Strain:CD-1
Age:10.0-10.5 dpc
Theiler Stage:TS16
Mutations:none (wild-type)
Preparation:wholemount
Procedures
Fixation:methanol/DMSO 4:1
Secondary Antibody:goat anti-rabbit
Labelled with:horse radish peroxidase
Visualisation method:DAB
General Information
Authors:Degenhardt K; Rentschler S; Fishman G; Sassoon DA, 2002 [PMID:11804784] . Indexed by GXD, Spatially mapped by EMAGE.
Submitted by:EMAGE EDITOR, Institute of Genetics and Molecular Medicine, Western General Hospital, Crewe Road, Edinburgh, UK EH4 2XU
Experiment type:non-screen
References:[ doi:10.1016/S0925-4773(01)00618-9] [ PMID:11804784] Degenhardt K, Rentschler S, Fishman G, Sassoon DA 2002 Cellular and cis-regulation of En-2 expression in the mandibular arch. Mech Dev (111):125-36
 [ PMID:1680044] Davis CA, Holmyard DP, Millen KJ, Joyner AL 1991 Examining pattern formation in mouse, chicken and frog embryos with an En-specific antiserum. Development (111):287-98
Links:MGI:2450113 same experiment
  Ensembl same gene
  Allen Brain Atlas same gene
  BioGPS same gene
  International Mouse Knockout Project Status same gene
  GEISHA Chicken ISH Database same gene
  EMBL-EBI Gene Expression Atlas same gene
  BrainStars same gene
  ViBrism same gene
Data SourceMGI